PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn017321
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LFY
Protein Properties Length: 365aa    MW: 40662.7 Da    PI: 7.8878
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn017321genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY607.23.4e-18513501386
     FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrl 99 
                 mdp+afs+slfkwdpr+ +a           v+++p        +r+l +le+lf+ayGvry+t+akiaelGftv+tL+dmk+eel+d+m+sls+ifr+
  Achn017321   1 MDPDAFSVSLFKWDPREGMA-----------VAAPP--------QRDLGGLEDLFQAYGVRYYTAAKIAELGFTVNTLLDMKEEELEDMMNSLSQIFRW 80 
                 9*************996652...........22233........46789************************************************** PP

     FLO_LFY 100 dllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaags.ggeglgeaelvaaeekkseeekkkaskkkqkrkk 197
                 dllvGeryGikaavraerrrl+eee  ++rr+lls+d+++aldalsqeglsee+vq++ eaags gg+g g +e+vaa+        kk+  +++++k 
  Achn017321  81 DLLVGERYGIKAAVRAERRRLDEEE--SRRRHLLSADTANALDALSQEGLSEERVQQK-EAAGSgGGTGGGGWEVVAAAG-----GGKKQ--QRRRKKG 169
                 ***********************87..99999**********************9885.555551566678899988873.....33333..1333333 PP

     FLO_LFY 198 kkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasy 296
                 + +          + +d+d++++g ++++rqrehPfivtepgevargkknGLDYLf+LyeqCrefL+qvq++akerGekcPtkvtnqvfryakkaga+y
  Achn017321 170 QAR--------MASFDDDDGTDGGGGSDHRQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLIQVQSVAKERGEKCPTKVTNQVFRYAKKAGANY 260
                 333........233445566677777889********************************************************************** PP

     FLO_LFY 297 inkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                 inkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawr+acykp+vaiaarqgwdid++fnahprL++WYvPtkLrqLCh+ers+a+
  Achn017321 261 INKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRHACYKPVVAIAARQGWDIDSIFNAHPRLAVWYVPTKLRQLCHAERSSAT 350
                 ***************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.2E-1871349IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDPDAFSVSL FKWDPREGMA VAAPPQRDLG GLEDLFQAYG VRYYTAAKIA ELGFTVNTLL  60
DMKEEELEDM MNSLSQIFRW DLLVGERYGI KAAVRAERRR LDEEESRRRH LLSADTANAL  120
DALSQEGLSE ERVQQKEAAG SGGGTGGGGW EVVAAAGGGK KQQRRRKKGQ ARMASFDDDD  180
GTDGGGGSDH RQREHPFIVT EPGEVARGKK NGLDYLFHLY EQCREFLIQV QSVAKERGEK  240
CPTKVTNQVF RYAKKAGANY INKPKMRHYV HCYALHCLDE EASNALRRAF KERGENVGAW  300
RHACYKPVVA IAARQGWDID SIFNAHPRLA VWYVPTKLRQ LCHAERSSAT ASSSASGEPE  360
HLPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1071913485162PROTEIN LEAFY
2vy2_A1e-1071913485162PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073600.10.0PREDICTED: LOW QUALITY PROTEIN: floricaula protein
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLA5A4R20.0A5A4R2_PLESU; Floricaula
TrEMBLM1L3050.0M1L305_9R
STRINGVIT_17s0000g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-106floral meristem identity control protein LEAFY (LFY)